PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00006935001
Common NameGSBRNA2T00006935001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 308aa    MW: 33371.6 Da    PI: 7.779
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00006935001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.2e-32108163156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  GSBRNA2T00006935001 108 KARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 163
                          68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.682105165IPR017930Myb domain
SuperFamilySSF466891.28E-17106166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28106166IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-27108163IPR006447Myb domain, plants
PfamPF002492.2E-7110161IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MTTAQLWSQP ETKPKNIDLT TDQSPKDELA SSPKLGHFDV KQRNGGGAFL PFSKEKTLPE  60
LALSTEVKRV SPANEHTNDH DCNGESIING SNNNNNNNSS TTSQSNRKAR RCWSPDLHRR  120
FVQALQMLGG SQVATPKQIR ELMKVDGLTN DEVKSHLQKY RLHTRRPSPS PQTSGGQGPH  180
LVVLGGIWVP PEYTTAHGGT PTLYHHQVQN HQGNAAAQPP PHFCSSQEFY TARPPPQQLH  240
HHHFQTCNGS SADGSASTDS ALQLTDSAGD DGKSPESGGG ERKGLAALRE ESGNQSNING  300
SEITLKF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013687047.10.0PREDICTED: uncharacterized protein LOC106391028
TrEMBLA0A078JYJ10.0A0A078JYJ1_BRANA; BnaAnng34750D protein
STRINGBra026548.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM71342843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-148G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]